Vierundsechzig Peptides VIERUNDSECHZIGPräzision · Kraft · Innovation ← Catálogo
FOXO4-DRI 10mg — vial de Longevidad & Anti-Edad Click para ampliar
Longevidad & Anti-Edad

FOXO4-DRI 10mg

Péptido D-retroinverso derivado del factor de transcripción FOXO4.

99% Pureza · Research Grade
Diseñado para interferir con la interacción entre FOXO4 y p53. Objeto de investigación en biología de la senescencia celular y modelos de envejecimiento.
₡75.000
Colones costarricenses
💬 Pedir por WhatsApp
Envíos a todo Costa Rica · SINPE Móvil · Transferencia

Ficha técnica Technical data sheet

⚠ Uso del producto · No apto para uso humano ni veterinario

Los productos de Vierundsechzig Peptides se suministran a profesionales de investigación y usuarios institucionales calificados, exclusivamente para investigación de laboratorio in vitro. Estos productos no son medicamentos, alimentos, cosméticos, productos de diagnóstico ni suplementos dietéticos, y no están destinados a uso humano ni animal. Cualquier uso de ese tipo está prohibido y puede infringir la legislación aplicable. Al comprar, el comprador declara y garantiza que el producto se utilizará únicamente para investigación in vitro.

Research Area

Longevity & Cellular Research

Chemical Information

  • Molecular Formula: C244H395N77O61
  • Molecular Weight: 5285 g/mol
  • Sequence: ltlrkeppppyleplgsrsrylsvhgrshllvpvdlvpdlrhgdlwrlrasrgtrsl *)
  • *) Notation Key: 1, 2, 3, 4 denote specific structural modifications consistent with the compound specification and corresponding certificate of analysis.

Product Description

This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended exclusively for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

Product Designation Note

This product is identified using an internal designation for cataloging and differentiation purposes. It is not marketed, labeled, or represented as any approved pharmaceutical or therapeutic compound.

Research Applications

In controlled laboratory research settings, this peptide analog is utilized to support investigation of:

  • Receptor binding interaction modeling involving modified peptide analogs
  • Comparative evaluation of synthetic peptide conjugation strategies
  • Structural integrity, degradation kinetics, and stability analysis
  • Screening assay development and analytical evaluation in controlled experimental systems

All research activities are conducted in non-human, non-clinical experimental models.

Storage and Handling

  • Store the lyophilized powder at −20 °C.
  • Once reconstituted, store at 2–8 °C and use promptly.
  • Maintain aseptic handling practices to ensure product quality and integrity.

Product Specifications

  • Purity: ≥99% (HPLC Certified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in suitable laboratory agents

Compliance Notice

This compound is FOR RESEARCH USE ONLY as an analytical reference material. The structural characteristics of this compound correspond to a synthetic D-retro-inverso peptide derived from the FOXO4 transcription factor, supplied as a research preparation and not approved for any indication. This research material is not an investigational drug product, is not intended for human or veterinary use, and has not been independently evaluated as a research compound. Misuse of this product is strictly prohibited and may violate applicable law. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

También en Longevidad & Anti-Edad